God.Of.War.3.PS3-DUPLEX

God.of.war.3.ps3-duplex [updated] · Premium

Phiewer PRO makes managing, viewing, and editing photos, RAW images, and videos faster and easier on Mac.

Pay once. Use forever.

What our users say

Reviews from the App Store

starstarstarstarstar

Fast, simple – excellent!

Just downloaded and loaded 500 images in 2 seconds. The slideshow function with various settings and fullscreen view is also a real plus. Replaced Pixea on my computer. After the recent update in January 2026, a real recommendation for me.

Felix theCat

starstarstarstarstar

perfect!

Perfect program to view and edit images. Extremely affordable price. Tried many others, Phiewer pro is outstanding!!

pyPeter01

starstarstarstarstar

Photo viewer that leaves no wish unfulfilled

It has already replaced Preview as my default photos viewer. Lightweight and battery-saving with an integrated photo editor, which is really impressive with its features for quick editing. As a teacher I use the app for academic purposes. Easy to use, self-explanatory, many functions, extensive options to design the way you want to see your photos! Friendly support team.

Man.Osm

#1 in the Photo & Video Charts on the Apple App Store in Germany, March 2026.

Featured on iFun.de

Buy once, use forever.

No subscription. Perfect for creatives & power users.

Phiewer PRO Mac photo viewer main window
Phiewer PRO gallery view for macOS
Phiewer PRO image editing filters on macOS
Phiewer PRO RAW image viewer for Mac
Phiewer PRO file management on macOS
Phiewer PRO Exposé gallery view
Phiewer PRO batch export and compression
Phiewer PRO Finder tags integration
Phiewer PRO pinboard view Mac
Phiewer PRO EXIF data viewer macOS

God.of.war.3.ps3-duplex [updated] · Premium

God.Of.War.3.PS3-DUPLEX refers to a specific scene release of the game God of War III for the PlayStation 3, distributed by the group In the context of PlayStation 3 homebrew and modding, a "solid feature"

typically describes a release that is stable, verified, and includes all necessary components to run on a modified console (Custom Firmware or HEN). 🎮 Game Specifications (Original PS3) Resolution: (revolutionary for 2010). Performance:

, though it frequently fluctuated depending on the intensity of the scene. 35–40 GB

(one of the largest PS3 titles due to high-quality uncompressed cinematics). Release Date: March 16, 2010. 🛠️ Release Details: DUPLEX

was a prominent release group during the PS3 era known for "cracking" games to run on internal or external hard drives without the original disc. Compatibility: Designed for consoles running Custom Firmware (CFW) Usually provided as a folder structure (JB Rip) or an ISO. Integrity:

DUPLEX releases were considered high-quality and "solid" because they rarely removed game data (like languages or cutscenes) to save space, ensuring a complete experience. 💻 Modern Alternative: RPCS3 (Emulation) If you are looking to play this release on a PC today, the emulator is the standard. RPCS3 Wiki "Playable" with the right hardware. Requirements: High-end CPU is mandatory for a stable frame rate. 4K resolution scaling and patches to lock the frame rate at 60 FPS. RPCS3 Wiki

God.Of.War.3.PS3-DUPLEX " refers to a specific digital release of God of War III

for the PlayStation 3, originally launched in March 2010. DUPLEX is the name of the "scene group" that packaged this particular version for use on modified consoles. The Game: A Masterpiece of Scale

God of War III is widely considered one of the greatest action games ever made and a technical marvel for the PS3 hardware.

Epic Scale: The game begins with Kratos and the Titans storming Mount Olympus, featuring massive boss battles against gods like Poseidon and Kronos that still impress today.

Stellar Combat: It refines the series' hack-and-slash mechanics with four distinct weapons, including the Blades of Exile and Nemean Cestus, allowing for fluid switching and brutal finishers. God.Of.War.3.PS3-DUPLEX

Visual Fidelity: Running at a native 720p with an unlocked frame rate (averaging 30–40 FPS), it pushed the PS3 to its absolute limits with detailed character models and zero loading screens.

Maturity & Tone: The game is famous for its extreme violence and "metal" atmosphere, depicting Kratos as a vengeful force of nature destroying the Greek world. Technical Breakdown


7. Summary

The God.Of.War.3.PS3-DUPLEX release is a standard ISO dump of the retail game, stripped of DRM for use on modified hardware. It represents a high-water mark for the PlayStation 3's graphical capabilities and remains a benchmark title for the system's late-cycle library.


Report generated for informational archiving purposes.

The identifier God.Of.War.3.PS3-DUPLEX refers to a specific digital release of the 2010 action-adventure game God of War III

by the scene group DUPLEX, known for their work in the PS3 homebrew and backup community. Below is a "deep paper" draft analyzing the game’s impact, narrative themes, and technical legacy.

The Zenith of Vengeance: A Critical Analysis of God of War III 1. Introduction: The Culmination of an Era

God of War III serves as the violent crescendo of Kratos's initial Greek saga. Released exclusively for the PlayStation 3, the game was designed to push the console's Cell Processor to its limits, delivering a scale of spectacle previously unseen in the genre. The "DUPLEX" tag associated with this release highlights the game’s enduring presence in the digital preservation and emulation communities, where it remains a benchmark for technical performance. 2. Technical Prowess and Aesthetic Scale

Resolution and Performance: On its native hardware, the game targeted a 720p resolution with an unlocked framerate that often hovered between 30 and 60 FPS.

Scale as Mechanics: The opening sequence—a battle atop the Titan Gaia as she scales Mount Olympus—transformed the environment itself into a living, moving character. This utilized "baked" lighting and massive texture detail to create a cinematic fidelity that rivaled CGI films of the time. Report generated for informational archiving purposes

Visceral Feedback: The game is notorious for its extreme "Violence & Gore," featuring high levels of blood and detailed anatomical destruction that emphasized the brutality of Kratos’s quest. 3. Narrative Themes: The Cost of Deicide

While the surface narrative focuses on the systematic execution of the Olympian pantheon, deeper subtexts explore:

Environmental Nihilism: Each god Kratos slays triggers a global catastrophe—Poseidon's death floods the world, and Helios's death eclipses the sun—illustrating that vengeance is inherently self-destructive.

The Sacrifice of Hope: The late-game introduction of Pandora shifts the theme from pure hate to the necessity of "Hope" (the power hidden at the bottom of Pandora’s Box) as a means to rebuild what has been broken.

The Price of Peace: Like many tragic epics, the game posits that true peace for a warrior like Kratos can only be achieved through ultimate sacrifice, a theme that resonates throughout the series. 4. Legacy and Modern Emulation

The "DUPLEX" release remains a point of interest for users of the RPCS3 emulator. Despite its high hardware requirements, the game is now considered playable from start to finish on modern CPUs, often at 4K resolutions and stable 60 FPS, effectively serving as a community-driven "remaster".

Watch the full gameplay and technical performance of God of War III running on modern hardware:

It seems you're asking about a release named "God of War 3 PS3-DUPLEX" — specifically a scene release group’s packaging of the game. Here’s a proper, factual guide to understanding what this means, without promoting or facilitating piracy.


The Morality of the Digital Ghost

While discussing God.Of.War.3-PS3.DUPLEX is a technical nostalgia trip, it also sits in a gray area. Did this release hurt sales? Probably not significantly. By the time the dump worked seamlessly, the game had already sold over 5 million copies.

However, the DUPLEX release allowed a second life for the game when PS3 disc drives started failing. It also kept the game alive in the early 2010s when Sony was slow to adopt proper backwards compatibility. Today, you can legally buy God of War 3 Remastered on PS4 and PC (via PS Plus). But back in 2011? If you had a jailbroken PS3, the DUPLEX rip was the only way to play the masterpiece without swapping discs. split into 1GB RARs

1. What Does “God of War 3 PS3-DUPLEX” Mean?

This naming follows the standard Scene Release Naming Convention: Game.Name.Platform-Group


Conclusion: The Ghost of Sparta in the Machine

The keyword God.Of.War.3.PS3-DUPLEX is more than a search term. It is a timestamp. It marks the moment when the most graphically intense game of 2010 was tamed by a handful of anonymous coders in Europe, split into 1GB RARs, and uploaded to a topsite in under twelve hours.

For modern gamers, God of War III is a $9.99 remaster on PS4. For the scene veterans, it is the EBOOT.BIN that broke the camel’s back. It is the 355th RAR file. It is the memory of watching Kratos impale Poseidon on a 2010 Samsung LCD, knowing the disc never moved.

Long live the scene. Long live DUPLEX.


Do you have a vintage PS3 running Rebug 4.84? Have you still got the original DUPLEX RARs on a dying 2.5-inch drive? Share your scene memories in the comments below (or, more appropriately, in the internal IRC channel).

File name: God.Of.War.3.PS3-DUPLEX NFO date: 03.14.2010 Greets: All PS3 scene groups 2009-2015. You are not forgotten.

Release Information Report

Title: God of War III Platform: PlayStation 3 (PS3) Release Group: DUPLEX File Name: God.Of.War.3.PS3-DUPLEX Genre: Action-Adventure / Hack and Slash Developer: Santa Monica Studio Publisher: Sony Computer Entertainment


Technical Specifications of the DUPLEX Dump

For the archivists and data hoarders, here is what the release typically contained:

Supported Formats

Over 80 file formats, from standard images to professional RAW formats.

God.Of.War.3.PS3-DUPLEX

Images

PNGJPGJPEGBMPGIFTIFFTIFHEICHEIFWebPICNSAVIFTGAEXRHDRPBMPGMPPMSGIMPO
PDFPSDEPSSVGICOJP2JPXPICT
RAW format support icon

RAW

3FRARIARWBAYCAPCR2CR3CRWDCRDCSDNGDRFEIPERFFFFHIFIIQK25KDCMEFMOSMRWNEFNRWOBMORFPEFPTXPXNR3DRAFRAWRWLRW2RWZSR2SRFSRWX3F
God.Of.War.3.PS3-DUPLEX

Videos & Audio

MP4MOVM4VM4AAVIMPGMPEG3GP3G2QTMTSM2TSTS
MP3WAVAIFFAIFAACCAFAC3FLAC

(lite) vs. PRO

Start free with Phiewer (lite) and upgrade when you're ready.

Phiewer PRO

One-time purchase
  • All (lite) features
  • Exposé, Pinboard & Grid
  • Search
  • Multi-selection
  • Filters & Image Editing
  • QuickEdit: Crop, Rotate, Flip
  • Complete Undo/Redo History
  • Multi-Export & Batch Compression
  • Finder Tags & Comments
  • Slideshow with Animations and Subdirectories
  • Video Controls
  • Share & Print
  • Custom Keyboard Shortcuts
  •  
One-time purchase on App Store

Ready to get started?

Download Phiewer PRO and experience a fast, reliable, and professional media viewer for Mac.

Requires macOS 15.0 or later